FOLD №10 — Retatrutide Lys-17 → Arg | GCGR Helix Stabilization

Verdict: PROMISING | pLDDT 0.782 | ipTM 0.19 | Stability 0.671

Mechanism of Action

Retatrutide is a synthetic 39-residue chimeric peptide triple agonist at the glucagon-like peptide-1 receptor (GLP-1R), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon receptor (GCGR). Its clinical efficacy — including up to 24.2% body weight reduction at 48 weeks in Phase 2 trials (Jastreboff et al., 2023) and robust glycemic improvements in T2D (Rosenstock et al., 2023) — arises from synergistic engagement of all three axes.

The GCGR arm is mechanistically distinct: glucagon receptor activation drives hepatic fat mobilization, increased energy expenditure, and potentially blood pressure reduction beyond what GLP-1R/GIPR agonism achieves alone. This makes the structural region of Retatrutide responsible for GCGR engagement a high-priority optimization target.

Class B GPCRs including GCGR are engaged by glucagon-family peptides through a two-domain mechanism: the N-terminus activates the transmembrane core, while the central amphipathic α-helix (~residues 10–25) docks into the extracellular domain (ECD) via hydrophobic packing and electrostatic contacts. Stabilizing this helix is a recognized strategy for improving ECD affinity and receptor residence time.

Modification Rationale

The substitution targets position 17 in Retatrutide's central α-helix:

Native:   YAQGTFTSDYSIYLDK-QAAKDFVQWLLAGGPSSGAPPPS
Modified: YAQGTFTSDYSIYLDER-QAAKDFVQWLLAGGPSSGAPPPS
                        ↑ K17R

Why Arg over Lys? Arginine's guanidinium group (pKa ~12.5 vs. Lys ε-amino pKa ~10.5) forms more persistent and geometrically diverse hydrogen bonds, including i,i+4 intrahelical contacts and bidentate salt bridges with backbone carbonyls. This is a well-characterized mechanism for increasing helical propensity and thermal stability in peptide engineering contexts. Position 17 sits on the solvent-exposed face of the helix in glucagon-family analogs and is not implicated as a direct receptor-binding-face contact in the broader class literature — making it a structurally permissive substitution site.

Why not the N-terminus? This fold is the direct strategic successor to FOLD №3, where an Aib-2 substitution in Retatrutide was discarded at pLDDT 0.71. That result suggested the N-terminal region is a structurally sensitive locus for modification, consistent with the literature showing the N-terminus of glucagon-family peptides is critical for both receptor activation and DPP-4 resistance. The current fold deliberately relocates the modification hypothesis to the more permissive central helix.

Predicted Properties

Signal: moderate. The monomer fold confidence (pLDDT 0.782) is a meaningful improvement over the Aib-2 discarded fold (pLDDT 0.71 in FOLD №3), confirming that position 17 is more structurally tolerant. Critically, no helix kinking or confidence drop in the 14–20 region was observed — the predicted failure mode did not materialize. The heuristic property profile is clean.

The limitation: ipTM 0.19 means the receptor-bound docking geometry cannot be interpreted from this run. This is the single factor preventing a REFINED verdict. The low interface score likely reflects the intrinsic difficulty of predicting class B GPCR–peptide induced-fit interfaces from a single-run prediction rather than a specific failure of the K17R modification — but this distinction cannot be resolved without ensemble runs or experimental data.

What Would Strengthen This Signal

Computational next steps:

1. Ensemble docking runs (≥5 independent predictions with varied seeds) to assess ipTM stability and identify whether any conformations show consistently higher interface confidence
2. Boltz-2 affinity module — the current run returned no affinity delta values; a dedicated Boltz-2 run against the GCGR ECD structure (PDB-derived or AlphaFold model) would provide a binding energy estimate
3. Comparative run: K17R vs. native Retatrutide in identical conditions to isolate the delta-pLDDT at residues 12–22 directly attributable to the substitution
4. GLP-1R and GIPR complex predictions — to confirm that the K17R substitution does not introduce steric clashes at the other two receptor interfaces (Arg's longer side chain is a legitimate concern at GLP-1R and GIPR binding faces)
5. Helix propensity calculation (e.g., AGADIR or similar) on the isolated 10–25 fragment to quantify the predicted helical content gain in isolation

Experimental validation that would resolve the verdict:

1. CD spectroscopy comparing native and K17R Retatrutide in aqueous buffer ± TFE — direct measurement of helical content change at position 17
2. Competitive radioligand binding assays at GCGR, GLP-1R, and GIPR in parallel — critical to confirm that K17R does not impair GLP-1R or GIPR affinity while testing the GCGR affinity hypothesis
3. cAMP functional assays at all three receptors — binding preservation does not guarantee agonist potency; functional equivalence at GLP-1R/GIPR alongside any GCGR improvement must be demonstrated
4. Thermal stability / circular dichroism thermal melt — to quantify any increase in helix melting temperature conferred by K17R

Cross-Fold Context

This fold is part of a growing Retatrutide modification series:

• FOLD №3 — Aib-2 substitution → DISCARDED (pLDDT 0.71). Established that N-terminal modifications destabilize the predicted fold. Directly motivated the shift to central-helix modification in the current fold.
• FOLD №10 (this fold) — K17R central helix → PROMISING (pLDDT 0.782). Confirms position 17 is more structurally permissive than position 2. Establishes the central helix as the productive modification locus for future Retatrutide engineering.

A logical next fold in this series would be a combined approach: K17R plus a C-terminal modification designed to further improve GCGR ECD docking — or alternatively, a K17R + Aib-2 combined analog, now that both positions have been characterized independently, to test whether the helix stabilization at position 17 can rescue the structural deficit observed with N-terminal Aib modification.

All data are in silico predictions. Heuristic property values are sequence-based estimates, not experimental measurements. This report does not constitute medical advice.